PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G328200.4
Common NameB456_009G328200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 566aa    MW: 63811.5 Da    PI: 6.9414
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G328200.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-13112152445
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         W ++E+ ll++a++++G g+W+ +a+++g +++  qc+++++
  Gorai.009G328200.4 112 WNADEEILLLEAIEMYGFGNWAEVAEHVG-TKSKSQCIDHYN 152
                         *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250243.7E-15841565IPR016827Transcriptional adaptor 2
SMARTSM002918.8E-104892IPR000433Zinc finger, ZZ-type
PfamPF005691.6E-85284IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.6775295IPR000433Zinc finger, ZZ-type
CDDcd023351.01E-2752100No hitNo description
SuperFamilySSF578501.29E-1352115No hitNo description
PROSITE patternPS0135705481IPR000433Zinc finger, ZZ-type
SuperFamilySSF466893.74E-13105158IPR009057Homeodomain-like
PROSITE profilePS5129322.521107159IPR017884SANT domain
SMARTSM007171.8E-12108157IPR001005SANT/Myb domain
PfamPF002492.4E-13111152IPR001005SANT/Myb domain
CDDcd001671.66E-12112152No hitNo description
Gene3DG3DSA:1.10.10.603.5E-9112154IPR009057Homeodomain-like
SuperFamilySSF466891.36E-17472563IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009409Biological Processresponse to cold
GO:0016573Biological Processhistone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MGRSRTVSRP TEEDLNQRSK RKKTASGSVD NVELPSAGLG QVPSEAKGPA LYHCNYCNKD  60
LSGMVRIKCA VCPDFDLCVE CFSVGAEITP HKCNHPYRVM DNLSFPLICP DWNADEEILL  120
LEAIEMYGFG NWAEVAEHVG TKSKSQCIDH YNAIYMNSPC FPLPDLSHVM GKSREELLAM  180
AKGNGLVKKE FTTHGELTLK QESPAGAKVK YETPRKEDPA HQSSSSLTGE IGSHIDSRSG  240
GNTFLGTGKK TSNMAQIKDG IKVEEPQADR SIGEKKPRVF TEEEPSMTEL SGYNFKRQEF  300
EIEYDNDAEQ LLADMEFKDT DTKAERELKL RVLHIYSKRL DERKRRKDFI LERNLLYPDP  360
FERNLSPEEK EIYQRYKVFM RFHSKEEHRE LLKSVIEEHR IVKRIQELQE ARAAGCRTAA  420
EANKFIEQKR KKEAEENAQR LKESVQAGPS GKVLLHGSPR GIVRGSPGLQ PFSKESSTVL  480
GQTTLSTLDD WDITGFIGAD LLSDSLCSEI RILPSHYLSM LQTLSMEIMK GNISKKSDAH  540
NLFKVEPSKV DRVYDMLVKK GIVQV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1342347RKRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448317.10.0PREDICTED: transcriptional adapter ADA2a-like
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A0D2TYU00.0A0A0D2TYU0_G
STRINGGLYMA13G11200.20.0(Glycine max)
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]